PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.013G146200.1
Common NameB456_013G146200, LOC105784182
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 348aa    MW: 38466.8 Da    PI: 8.3274
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.013G146200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.91.1e-333286155
             G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        kprlrWt eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl
  Gorai.013G146200.1 32 KPRLRWTVELHERFVDAVTQLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQKFRL 86
                        79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.3472989IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.2E-322987IPR009057Homeodomain-like
SuperFamilySSF466891.56E-163187IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-233287IPR006447Myb domain, plants
PfamPF002491.1E-73484IPR001005SANT/Myb domain
PfamPF143793.1E-22121160IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010088Biological Processphloem development
GO:0010089Biological Processxylem development
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MFQPKKPTTM NSHDRPMCVQ GDSGLVLTTD PKPRLRWTVE LHERFVDAVT QLGGPDKATP  60
KTIMRVMGVK GLTLYHLKSH LQKFRLGKQP HKEINDHSMK DDLQRSAASS SGMMARSMNE  120
MQMEVQRRLH EQLEVQRHLQ LRIEAQGKYM QSILEKACQT LAGENMASGG YKGMGNQGVP  180
DIGAMKDFGP LNFPPFQDLN IYGGDQLDLP HNMDRPLVDG FISNNDNTCL GKKRPSPYSG  240
SGKSPLIWSD DLRLQDLGTA PSCLGPQDDP FKTDQIQLAP PSTELDSISE IYDAKPVLSG  300
DGIGEKKFEA SPKLERPSPR RAALQTERMN PMINSGSVAQ GRNSPFG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF8129696e-54JF812969.1 Theobroma cacao clone GU261 microsatellite mTc-UNICAMP02 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012465440.10.0PREDICTED: myb family transcription factor APL
SwissprotQ9SAK51e-132APL_ARATH; Myb family transcription factor APL
TrEMBLA0A0D2VDV40.0A0A0D2VDV4_G
STRINGVIT_19s0085g00890.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50442750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79430.21e-124G2-like family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]